PDB entry 1rqm

View 1rqm on RCSB PDB site
Description: solution structure of the k18g/r82e alicyclobacillus acidocaldarius thioredoxin mutant
Class: oxidoreductase
Keywords: THIOREDOXIN FOLD, Redox-active Center, OXIDOREDUCTASE
Deposited on 2003-12-05, released 2004-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Alicyclobacillus acidocaldarius [TaxId:405212]
    Gene: trxA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80579 (0-104)
      • engineered (17)
      • engineered (81)
    Domains in SCOPe 2.07: d1rqma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rqmA (A:)
    atmtltdanfqqaiqgdgpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
    pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq