PDB entry 1rqh

View 1rqh on RCSB PDB site
Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to pyruvic acid
Class: transferase
Keywords: TIM-barrel, carbamylated lysine, transcarboxylase, cobalt, pyruvic acid, TRANSFERASE
Deposited on 2003-12-05, released 2004-09-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.164
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcarboxylase 5S subunit
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Gene: 5S
    Database cross-references and differences (RAF-indexed):
    • GB CAE54442
      • microheterogeneity (194)
    Domains in SCOPe 2.04: d1rqha1, d1rqha2
  • Heterogens: CO, PYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqhA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggatydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqhA (A:)
    reievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyds
    cirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdvf
    rvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsial
    kdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtais
    smslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsif
    ksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfnv
    mmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekqs
    keaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea