PDB entry 1rqe

View 1rqe on RCSB PDB site
Description: Propionibacterium shermanii transcarboxylase 5S subunit bound to oxaloacetate
Class: transferase
Keywords: TIM-barrel, carbamylated lysine, transcarboxylase, cobalt, oxaloacetate, TRANSFERASE
Deposited on 2003-12-05, released 2004-09-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.152
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcarboxylase 5S subunit
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Gene: 5S
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rqea1, d1rqea2
  • Heterogens: OAA, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqeA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggatydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqeA (A:)
    preievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyd
    scirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdv
    frvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsia
    lkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtai
    ssmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsi
    fksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfn
    vmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekq
    skeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea