PDB entry 1rqb

View 1rqb on RCSB PDB site
Description: Propionibacterium shermanii transcarboxylase 5S subunit
Class: transferase
Keywords: TIM-barrel, carbamylated lysine, transcarboxylase, TRANSFERASE
Deposited on 2003-12-04, released 2004-09-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.162
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcarboxylase 5S subunit
    Species: Propionibacterium freudenreichii subsp. shermanii [TaxId:1752]
    Gene: 5S
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70AC7
      • modified residue (39)
      • modified residue (43)
      • modified residue (45)
      • modified residue (48)
      • modified residue (93)
      • modified residue (100)
      • modified residue (130)
      • modified residue (139)
      • modified residue (145)
      • modified residue (149)
      • modified residue (186)
      • modified residue (194)
      • modified residue (196)
      • modified residue (238)
      • modified residue (255)
      • modified residue (270)
      • modified residue (321)
      • modified residue (325)
      • modified residue (338)
      • modified residue (342)
      • modified residue (374-375)
      • modified residue (381)
      • modified residue (389)
    Domains in SCOPe 2.05: d1rqba1, d1rqba2
  • Heterogens: CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rqbA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggatydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rqbA (A:)
    preievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggatyd
    scirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdv
    frvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsia
    lkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtai
    ssmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsi
    fksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfn
    vmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekq
    skeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea