PDB entry 1rpl

View 1rpl on RCSB PDB site
Description: 2.3 angstroms crystal structure of the catalytic domain of dna polymerase beta
Deposited on 1994-10-25, released 1995-01-26
The last revision prior to the SCOP 1.67 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1rpl_ (-)
    lekirqddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfe
    dfekripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftses
    skqpkllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdq
    yycgvlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiq
    wryrepkdrse
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rpl_ (-)
    ssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfekripree
    mlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqpkllhrv
    veqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycgvlyftg
    sdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepkdrs
    e