PDB entry 1rpj

View 1rpj on RCSB PDB site
Description: crystal structure of d-allose binding protein from escherichia coli
Class: periplasmic sugar receptor
Keywords: periplasmic sugar receptor
Deposited on 1999-02-04, released 1999-02-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.194
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (precursor of periplasmic sugar receptor)
    Species: Escherichia coli K12 [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rpja_
  • Heterogens: ZN, SO4, ALL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpjA (A:)
    aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
    kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
    gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
    ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
    mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq