PDB entry 1rpa

View 1rpa on RCSB PDB site
Description: three-dimensional structure of rat acid phosphatase in complex with l(+) tartrate
Deposited on 1993-06-12, released 1994-05-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 3 Å
R-factor: 0.215
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1rpa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rpa_ (-)
    kelkfvtlvfrhgdrgpietfpndpikesswpqgfgqltkwgmgqhyelgsyirrrygrf
    lnnsykhdqvyirstdvdrtlmsamtnlaalfppegnsiwnprllwqpipvhtvslsedr
    llylpfrdcprfqelksetlkseeflkrlqpyksfidtlpslsgfedqdlfeiwsrlydp
    lycesvhnftlptwatedamtklkelselsllslygihkqkeksrlqggvlvneilknmk
    latqpqkarklimysahdttvsglqmaldvyngllppyaschimelyqdngghfvemyyr
    netqnepypltlpgcthscplekfaelldpvipqdwatecmg