PDB entry 1rou

View 1rou on RCSB PDB site
Description: structure of fkbp59-I, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
Class: rotamase (isomerase)
Keywords: rotamase (isomerase), domain I (n-term) of a 59 kda, fk506-binding protein, peptidyl prolyl cis-trans isomerase
Deposited on 1996-06-14, released 1996-12-07
The last revision prior to the SCOP 1.73 freeze date was dated 1996-12-07, with a file datestamp of 2007-06-04.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fkbp59-I
    Species: Oryctolagus cuniculus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1roua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1rouA (A:)
eemdikaaesgaqsaplplegvdispkqdegvlkvikregtgtetpmigdrvfvhytgwl
ldgtkfdssldrkdkfsfdlgkgevikawdiavatmkvgelcritckpeyaygsagsppk
ippnatlvfevelfefkgedltddedgvp

    Sequence, based on observed residues (ATOM records): (download) 
    >1rouA (A:)
gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg