PDB entry 1ro9

View 1ro9 on RCSB PDB site
Description: CRYSTAL STRUCTURES OF THE CATALYTIC DOMAIN OF PHOSPHODIESTERASE 4B2B COMPLEXED WITH 8-Br-AMP
Class: hydrolase
Keywords: PDE, 8-Br-AMP, HYDROLASE
Deposited on 2003-12-01, released 2004-12-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.13 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (1-End)
      • engineered mutation (336)
      • engineered mutation (338)
    Domains in SCOPe 2.05: d1ro9a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4B
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07343 (1-End)
      • engineered mutation (336)
    Domains in SCOPe 2.05: d1ro9b_
  • Heterogens: ZN, 8BR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ro9A (A:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro9A (A:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqapa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ro9B (B:)
    msisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfr
    issdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifa
    aaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkq
    rqtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhc
    adlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyi
    vhplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeqnrdcqglmekfqfel
    tldeedsegpekegeghs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ro9B (B:)
    sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
    ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
    aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
    qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
    dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
    hplwetwadlvqpdaqdildtlednrnwyqsmipqap