PDB entry 1rnr

View 1rnr on RCSB PDB site
Description: autocatalytic generation of dopa in the engineered protein r2 f208y from escherichia coli ribonucleotide reductase and crystal structure of the dopa-208 protein
Class: oxidoreductase
Keywords: reductase(acting on ch2), oxidoreductase
Deposited on 1993-04-26, released 1994-01-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonucleotide reductase r1 protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • conflict (6)
      • conflict (23)
      • engineered mutation (207)
      • conflict (325)
    Domains in SCOPe 2.07: d1rnra_
  • Chain 'B':
    Compound: ribonucleotide reductase r1 protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P69924 (0-End)
      • conflict (6)
      • conflict (23)
      • engineered mutation (207)
      • conflict (325)
    Domains in SCOPe 2.07: d1rnrb_
  • Heterogens: FE, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rnrA (A:)
    ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rnrA (A:)
    ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rnrB (B:)
    ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlvsdnvqvapqevevssylvgq
    idsevdtddlsnfql
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rnrB (B:)
    ayttfsatkndqlkepmffgqpvqvarydqqkydifekliekqlsffwrpeevdvsrdri
    dyqalpehekhifisnlkyqtlldsiqgrspnvallplisipeletwvetwafsetihsr
    sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
    tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
    hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
    kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv