PDB entry 1rnb

View 1rnb on RCSB PDB site
Description: crystal structure of a barnase-d(*gp*c) complex at 1.9 angstroms resolution
Deposited on 1991-03-19, released 1992-07-15
The last revision prior to the SCOP 1.63 freeze date was dated 1994-07-31, with a file datestamp of 1994-08-02.
Experiment type: -
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1rnba_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rnbA (A:)
  qvintfdgvadylqtyhklpndyitkseaqalgwvaskgnladvapgksiggdifsnreg
  klpgksgrtwreadinytsgfrnsdrilyssdwliykttdhyqtftkir