PDB entry 1rmh

View 1rmh on RCSB PDB site
Description: recombinant cyclophilin a from human t cell
Class: isomerase/ isomerase substrate
Keywords: complex (isomerase-substrate), isomerase- isomerase substrate complex
Deposited on 1995-07-31, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rmha_
  • Chain 'B':
    Compound: cyclophilin a
    Species: Homo sapiens [TaxId:9606]
    Gene: CYCLOPHILIN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rmhb_
  • Chain 'C':
    Compound: aapf peptide substrate
    Database cross-references and differences (RAF-indexed):
    • PDB 1RMH (0-5)
  • Chain 'D':
    Compound: aapf peptide substrate
    Database cross-references and differences (RAF-indexed):
    • PDB 1RMH (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmhA (A:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmhB (B:)
    vnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfm
    cqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktew
    ldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.