PDB entry 1rmf

View 1rmf on RCSB PDB site
Description: structures of a monoclonal anti-icam-1 antibody r6.5 fragment at 2.8 angstroms resolution
Deposited on 1994-12-16, released 1995-02-27
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-27, with a file datestamp of 1995-02-28.
Experiment type: -
Resolution: 2.8 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmfH (H:)
    qvqlqqsgpelvrpgvsvkisckgsgytfidyaihwvkeshakslewigvisaysgdtny
    nqkfkgkatmtvdkssntaylelarltsedsaiyycarggwlllsfdywgqgttltvssa
    kttapsvtplapvcgdttgssvtlgvlvkgyfpepvtltwnsgslssgvhtfpavlqsdl
    ytlsssvtvtsstwpsqsitcnvahpasstkvdkki
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rmfL (L:)
    dvvmtqsplslpvslgdqasiscrssqslvhsngnnylhwylqksgqapklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpltfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec