PDB entry 1rm5

View 1rm5 on RCSB PDB site
Description: crystal structure of mutant s188a of photosynthetic glyceraldehyde-3- phosphate dehydrogenase a4 isoform, complexed with nadp
Deposited on 2003-11-27, released 2004-07-27
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm5A (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldaahrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm5B (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldaahrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm5O (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindtggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldaahrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa