PDB entry 1rm3

View 1rm3 on RCSB PDB site
Description: Crystal structure of mutant T33A of photosynthetic glyceraldehyde-3-phosphate dehydrogenase A4 isoform, complexed with NADP
Deposited on 2003-11-27, released 2004-07-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-27, with a file datestamp of 2004-07-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.212
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rm3A (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rm3A (A:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm3B (B:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rm3O (O:)
    klkvaingfgrigrnflrcwhgrkdspldvvvindaggvkqashllkydsilgtfdadvk
    tagdsaisvdgkvikvvsdrnpvnlpwgdmgidlviegtgvfvdrdgagkhlqagakkvl
    itapgkgdiptyvvgvneegythadtiisnascttnclapfvkvldqkfgiikgtmttth
    sytgdqrlldashrdlrraraaclnivptstgaakavalvlpnlkgklngialrvptpnv
    svvdlvvqvskktfaeevnaafresadnelkgilsvcdeplvsidfrctdvsstidsslt
    mvmgddmvkviawydnewgysqrvvdladivankwqa