PDB entry 1rlp

View 1rlp on RCSB PDB site
Description: two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
Class: complex (signal transduction/peptide)
Keywords: complex (signal transduction/peptide)
Deposited on 1994-10-10, released 1995-02-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: c-src tyrosine kinase sh3 domain
    Species: Gallus gallus [TaxId:9031]
    Gene: SYNTHETIC OLIGO
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rlpc_
  • Chain 'R':
    Compound: proline-rich ligand rlp2 (ralpplpry)
    Database cross-references and differences (RAF-indexed):
    • PDB 1RLP (0-8)

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download) 
    >1rlpC (C:)
galaggvttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsny
vaps

    Sequence, based on observed residues (ATOM records): (download) 
    >1rlpC (C:)
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

  • Chain 'R':
    No sequence available.