PDB entry 1rll

View 1rll on RCSB PDB site
Description: Structural Basis for the Coordinated Regulation of Transglutaminase 3 by Guanine Nucleotides and Calcium/Magnesium
Class: transferase
Keywords: Transglutaminase 3, X-ray crystallography, metalloenzyme, calcium ion
Deposited on 2003-11-25, released 2004-01-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-03-02, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein-glutamine glutamyltransferase E
    Species: HOMO SAPIENS
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • engineered (263)
    Domains in SCOPe 2.07: d1rlla1, d1rlla2, d1rlla3, d1rlla4
  • Chain 'B':
    Compound: Protein-glutamine glutamyltransferase E
    Species: HOMO SAPIENS
    Gene: TGM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q08188 (0-691)
      • engineered (263)
    Domains in SCOPe 2.07: d1rllb1, d1rllb2, d1rllb3, d1rllb4
  • Heterogens: CA, MG, GSP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rllA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rllA (A:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpepsiigklkvagmlavgke
    vnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpikisya
    qyerylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvqmlfs
    npldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqlladfscn
    kfpaikamlsidvae
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rllB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklkpntpfaatssmgleteeqep
    siigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatm
    sldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildnptltlev
    lnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdi
    lpsrsgtkqlladfscnkfpaikamlsidvae
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rllB (B:)
    aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
    pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
    gissvklgtfillfnpwlnvdsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqf
    eedilsiclsildrslnfrrdaatdvasrndpkyvgrvlsaminsnddngvlagnwsgty
    tggrdprswdgsveilknwkksglspvrygqcwvfagtlntalrslgipsrvitnfnsah
    dtdrnlsvdvyydpmgnpldkgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqers
    qgvfqcgpasvigvregdvqlnfdmpfifaevnadritwlydnttgkqwknsvnshtigr
    yistkavgsnarmdvtdkykypegsdqerqvfqkalgklleteeqepsiigklkvagmla
    vgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsatmsldpeeeaehpik
    isyaqyerylksdnmiritavckvpdesevvverdiildnptltlevlnearvrkpvnvq
    mlfsnpldepvrdcvlmvegsglllgnlkidvptlgpkersrvrfdilpsrsgtkqllad
    fscnkfpaikamlsidvae