PDB entry 1rl8

View 1rl8 on RCSB PDB site
Description: Crystal structure of the complex of resistant strain of hiv-1 protease(v82a mutant) with ritonavir
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic protease, aspartic protease-inhibitor complex, resistant strain, hydrolase-hydrolase inhibitor complex
Deposited on 2003-11-25, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • variant (40)
      • engineered (81)
    Domains in SCOPe 2.07: d1rl8a_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • variant (40)
      • engineered (81)
    Domains in SCOPe 2.07: d1rl8b_
  • Heterogens: RIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rl8A (A:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rl8B (B:)
    pqitlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpaniigrnlltqigctlnf