PDB entry 1rl8

View 1rl8 on RCSB PDB site
Description: Crystal structure of the complex of resistant strain of hiv-1 protease(v82a mutant) with ritonavir
Class: hydrolase/hydrolase inhibitor
Keywords: aspartic protease, aspartic protease-inhibitor complex, resistant strain, hydrolase-hydrolase inhibitor complex
Deposited on 2003-11-25, released 2005-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.226
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • variant (40)
    • engineered (81)
  Domains in SCOPe 2.08: d1rl8a_
• Chain 'B':
  Compound: protease retropepsin
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: gag-pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03367 (0-98)
    • variant (40)
    • engineered (81)
  Domains in SCOPe 2.08: d1rl8b_
• Heterogens: RIT, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rl8A (A:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpaniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rl8B (B:)
  pqitlwqrplvtikiggqlkealldtgaddtvleemslpgawkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpaniigrnlltqigctlnf