PDB entry 1rl6

View 1rl6 on RCSB PDB site
Description: ribosomal protein l6
Class: RNA-binding protein
Keywords: RNA-binding protein, gentamicin resistance, ribosomal protein, alpha/beta protein
Deposited on 1999-01-14, released 1999-02-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.257
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribosomal protein l6)
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rl6a1, d1rl6a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rl6A (A:)
    srvgkkpieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhh
    ralhgttrsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegl
    eievpsqtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrlkegktgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rl6A (A:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl