PDB entry 1rkn

View 1rkn on RCSB PDB site
Description: Solution structure of 1-110 fragment of Staphylococcal Nuclease with G88W mutation
Class: hydrolase
Keywords: staphylococcal nuclease, folding, G88W110, HYDROLASE
Deposited on 2003-11-22, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thermonuclease
  Species: Staphylococcus aureus [TaxId:1280]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00644 (0-109)
    • engineered (87)
  Domains in SCOPe 2.08: d1rkna_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rknA (A:)
  atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
  ftkkmvenakkievefdkgqrtdkygrwlayiyadgkmvnealvrqglak