PDB entry 1rkj

View 1rkj on RCSB PDB site
Description: Solution structure of the complex formed by the two N-terminal RNA-binding domains of nucleolin and a pre-rRNA target
Class: Transcription/RNA
Keywords: Protein-RNA complex, RBD, Transcription/RNA COMPLEX
Deposited on 2003-11-21, released 2004-04-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleolin
    Species: Mesocricetus auratus [TaxId:10036]
    Gene: NCL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08199 (4-174)
      • cloning artifact (0-3)
      • see remark 999 (36)
    Domains in SCOPe 2.06: d1rkja1, d1rkja2, d1rkja3
  • Chain 'B':
    Compound: 5'-r(*gp*gp*ap*up*gp*cp*cp*up*cp*cp*cp*gp*ap*gp*up*gp*cp*ap*up*cp*c)-3'
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1rkjA (A:)
gshmvegsesttpfnlfignlnpnksvaelkvaiselfakndlavvdvrtgtnrkfgyvd
fesaedlekaleltglkvfgneiklekpkgrdskkvraartllaknlsfnitedelkevf
edaleirlvsqdgkskgiayiefkseadaeknleekqgaeidgrsvslyytgekg

  • Chain 'B':
    No sequence available.