PDB entry 1rk9

View 1rk9 on RCSB PDB site
Description: Solution Structure of Human alpha-Parvalbumin (Minimized Average Structure)
Class: metal binding protein
Keywords: calcium, parvalbumin, EF-hand, NMR, lanthanide, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2003-11-21, released 2004-06-08
The last revision prior to the SCOP 1.75 freeze date was dated 2004-06-08, with a file datestamp of 2007-07-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parvalbumin alpha
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P20472 (1-109)
    • insertion (0)
  Domains in SCOP 1.75: d1rk9a_
• Heterogens: CA

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1rk9A (A:)
  msmtdllnaedikkavgafsatdsfdhkkffqmvglkkksaddvkkvfhmldkdksgfie
  edelgfilkgfspdardlsaketkmlmaagdkdgdgkigvdefstlvaes