PDB entry 1rk8

View 1rk8 on RCSB PDB site
Description: Structure of the cytosolic protein PYM bound to the Mago-Y14 core of the exon junction complex
Class: translation
Keywords: mRNA processing; RRM; RBD; NMD; oskar mRNA localization, TRANSLATION
Deposited on 2003-11-21, released 2004-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.235
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CG8781-PA protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: TSU
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rk8a_
  • Chain 'B':
    Compound: mago nashi protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: MAGO,MGN,CG9401
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rk8b_
  • Chain 'C':
    Compound: Within the bgcn gene intron protein
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: WIBG,PYM,CG30176/CG10330
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rk8c_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rk8A (A:)
    madvldidnaeefevdedgdqgivrlkekakhrkgrgfgsdsntreaihsyervrneddd
    elepgpqrsvegwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalve
    yethkqalaakealngaeimgqtiqvdwcfvkgpkrvkksekrrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8A (A:)
    pqrsvgwilfvtsiheeaqedeiqekfcdygeiknihlnldrrtgfskgyalveyethkq
    alaakealngaeimgqtiqvdwcfvkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rk8B (B:)
    mstedfylryyvghkgkfgheflefefrpdgklryannsnykndtmirkeafvhqsvmee
    lkriiidseimqeddlpwpppdrvgrqeleivigdehisfttsktgslvdvnrskdpegl
    rcfyylvqdlkclvfsliglhfkikpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8B (B:)
    edfylryyvgheflefefrpdgklryanmirkeafvhqsvmeelkriiidseimqeddlp
    wpppdrvgrqeleivigdehisfttsktgslvdvnrskdpeglrcfyylvqdlkclvfsl
    iglhfki
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rk8C (C:)
    mstylqssegkfipatkrpdgtwrkarrvkdgyvpqeevplyeskgkqfvaqrqagvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rk8C (C:)
    tylqssegkfipatkrpdgtwrkarrvkdgyvp