PDB entry 1rk7

View 1rk7 on RCSB PDB site
Description: Solution structure of apo Cu,Zn Superoxide Dismutase: role of metal ions in protein folding
Class: oxidoreductase
Keywords: apo form of monomeric mutant of Cu,Zn SOD; solution structure, NMR, Q133M2SOD, OXIDOREDUCTASE
Deposited on 2003-11-21, released 2003-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered (5)
      • engineered (49-50)
      • engineered (110)
      • engineered (132)
    Domains in SCOPe 2.07: d1rk7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rk7A (A:)
    atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvheeedntagctsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
    ekaddlgkggneqstktgnagsrlacgvigiaq