PDB entry 1rjp

View 1rjp on RCSB PDB site
Description: Crystal structure of D-aminoacylase in complex with 100mM CuCl2
Class: hydrolase
Keywords: TIM barrel, beta barrel, insertion, HYDROLASE
Deposited on 2003-11-20, released 2004-04-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.186
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-aminoacylase
    Species: Alcaligenes faecalis [TaxId:511]
    Gene: DA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rjpa1, d1rjpa2, d1rjpa3
  • Heterogens: ACT, ZN, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjpA (A:)
    mrgshhhhhhgsmsqpdatpfdyilsggtvidgtnapgrladvgvrgdriaavgdlsass
    arrridvagkvvspgfidshthddnyllkhrdmtpkisqgvttvvtgncgislaplahan
    ppapldlldeggsfrfarfsdylealraappavnaacmvghstlraavmpdlrreatade
    iqamqaladdalasgaigistgafyppaahasteeiievcrplithggvyathmrdegeh
    ivqaleetfrigreldvpvvishhkvmgklnfgrsketlalieaamasqdvsldaypyva
    gstmlkqdrvllagrtlitwckpypelsgrdleeiaaergkskydvvpelqpagaiyfmm
    depdvqrilafgptmigsdglphderphprlwgtfprvlghysrdlglfpletavwkmtg
    ltaakfglaergqvqpgyyadlvvfdpatvadsatfehpteraagihsvyvngaavwedq
    sftgqhagrvlnraga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjpA (A:)
    pfdyilsggtvidgtnapgrladvgvrgdriaavgdlsassarrridvagkvvspgfids
    hthddnyllkhrdmtpkisqgvttvvtgncgislaplahanppapldlldeggsfrfarf
    sdylealraappavnaacmvghstlraavmpdlrreatadeiqamqaladdalasgaigi
    stgafyppaahasteeiievcrplithggvyathmrdegehivqaleetfrigreldvpv
    vishhkvmgklnfgrsketlalieaamasqdvsldaypyvagstmlkqdrvllagrtlit
    wckpypelsgrdleeiaaergkskydvvpelqpagaiyfmmdepdvqrilafgptmigsd
    glphderphprlwgtfprvlghysrdlglfpletavwkmtgltaakfglaergqvqpgyy
    adlvvfdpatvadsatfehpteraagihsvyvngaavwedqsftgqhagrvlnr