PDB entry 1rjo

View 1rjo on RCSB PDB site
Description: AGAO + Xe
Class: oxidoreductase
Keywords: CAO, CuAO, copper-containing, amine oxidase, oxygen binding site, dioxygen binding site, xenon, TPQ, quinone, trihydroxyphenylalanine quinone, OXIDOREDUCTASE
Deposited on 2003-11-19, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylethylamine oxidase
    Species: Arthrobacter globiformis [TaxId:1665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46881
      • modified residue (379)
    Domains in SCOPe 2.07: d1rjoa1, d1rjoa2, d1rjoa3
  • Heterogens: CU, NA, SO4, XE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjoA (A:)
    pstiqtaspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrv
    fihdvsgarpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkal
    aarnldvskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvv
    skevtrvidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewek
    wsldvgfdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgey
    lvgqyanslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsgi
    nytrrnrrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisql
    apglgapfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltrese
    avreadartgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlw
    vtryadderyptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpim
    pvdtvgfklrpegffdrspvldvpanpsqsgshchgsnwshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjoA (A:)
    aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
    garpqevtvsvtngtvisaveldtaatgelpvleeefevveqllatderwlkalaarnld
    vskvrvaplsagvfeyaeergrrilrglafvqdfpedsawahpvdglvayvdvvskevtr
    vidtgvfpvpaehgnytdpeltgplrttqkpisitqpegpsftvtggnhiewekwsldvg
    fdvregvvlhniafrdgdrlrpiinrasiaemvvpygdpspirswqnyfdtgeylvgqya
    nslelgcdclgditylspvisdafgnpreirngicmheedwgilakhsdlwsginytrrn
    rrmvisffttignydygfywylyldgtiefeakatgvvftsafpeggsdnisqlapglga
    pfhqhifsarldmaidgftnrveeedvvrqtmgpgnergnafsrkrtvltreseavread
    artgrtwiisnpesknrlnepvgyklhahnqptlladpgssiarraafatkdlwvtryad
    deryptgdfvnqhsggaglpsyiaqdrdidgqdivvwhtfglthfprvedwpimpvdtvg
    fklrpegffdrspvldvpan