PDB entry 1rjl

View 1rjl on RCSB PDB site
Description: Structure of the complex between OspB-CT and bactericidal Fab-H6831
Deposited on 2003-11-19, released 2004-11-30
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-30, with a file datestamp of 2004-11-30.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.191
AEROSPACI score: -1.69 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlA (A:)
    diqmnqspsslsaslgdtititchasqninvwlnwfqqkpgsipklliymasnlhtgvps
    rfsgsgsgtgftltisslqpediatyycqqgqsfpltfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlB (B:)
    qvqlqqpgsvlvrpgasvklsckasgftftsswmhwakqrpgqglewigeihpnsgnthy
    nekfkgkatltvdtssstayvdlssltsedsavyycarmrygdyyamdnwgqgtsvtvss
    akttappvyplapvcgdttgssvtlgclvkgyfpesvtllwnsgslssgvhtfpavlqsd
    lytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rjlC (C:)
    tveikegtvtlkreiekdgkvkvflndtagsnkktgkwedststltisadskktkdlvfl
    tdgtitvqqyntagtslegsaseiknlselknalk