PDB entry 1rjb

View 1rjb on RCSB PDB site
Description:
Deposited on 2003-11-19, released 2004-02-03
The last revision prior to the SCOP 1.67 freeze date was dated 2004-02-03, with a file datestamp of 2004-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.21
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1rjba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rjbA (A:)
    hkykkqfryesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgk
    vmnataygisktgvsiqvavkmlkekadsserealmselkmmtqlgshenivnllgactl
    sgpiylifeyccygdllnylrskrekfsedeieyenqkrleeeedlnvltfedllcfayq
    vakgmeflefkscvhrdlaarnvlvthgkvvkicdfglardimsdsnyvvrgnarlpvkw
    mapeslfegiytiksdvwsygillweifslgvnpypgipvdanfykliqngfkmdqpfya
    teeiyiimqscwafdsrkrpsfpnltsflgcqladaeeamyqnv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rjbA (A:)
    yesqlqmvqvtgssdneyfyvdfreyeydlkwefprenlefgkvlgsgafgkvmnatayg
    isktgvsiqvavkmlkerealmselkmmtqlgshenivnllgactlsgpiylifeyccyg
    dllnylrskrekfltfedllcfayqvakgmeflefkscvhrdlaarnvlvthgkvvkicd
    fglardimsdsnyvvrgnarlpvkwmapeslfegiytiksdvwsygillweifslgvnpy
    pgipvdanfykliqngfkmdqpfyateeiyiimqscwafdsrkrpsfpnltsflgcql