PDB entry 1rj6

View 1rj6 on RCSB PDB site
Description: Crystal Structure of the Extracellular Domain of Murine Carbonic Anhydrase XIV in Complex with Acetazolamide
Class: lyase
Keywords: beta-sheet, alpha-helix, zinc enzyme, lyase
Deposited on 2003-11-18, released 2004-03-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase XIV
    Species: Mus musculus [TaxId:10090]
    Gene: CA14, CAR14, CATM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVT6 (Start-260)
      • see remark 999 (106)
    Domains in SCOPe 2.03: d1rj6a_
  • Chain 'B':
    Compound: Carbonic anhydrase XIV
    Species: Mus musculus [TaxId:10090]
    Gene: CA14, CAR14, CATM
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WVT6 (Start-260)
      • see remark 999 (106)
    Domains in SCOPe 2.03: d1rj6b_
  • Heterogens: ZN, AZM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rj6A (A:)
    gghhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepl
    dlhnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvv
    hydsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfs
    vrelfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpse
    plvqnyrvpqplnqrtifasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj6A (A:)
    hhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldl
    hnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhy
    dsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvr
    elfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpsepl
    vqnyrvpqplnqrtifasf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rj6B (B:)
    gghhwtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepl
    dlhnnghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvv
    hydsqsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfs
    vrelfpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpse
    plvqnyrvpqplnqrtifasf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rj6B (B:)
    wtyegphgqdhwptsypecggdaqspiniqtdsvifdpdlpavqphgydqlgtepldlhn
    nghtvqlslpptlhlgglprkytaaqlhlhwgqrgslegsehhinseataaelhvvhyds
    qsysslseaaqkpqglavlgilievgetenpaydhilsrlheirykdqktsvppfsvrel
    fpqqleqffryngslttppcyqsvlwtvfnrraqismgqleklqetlssteedpseplvq
    nyrvpqplnqrtifasf