PDB entry 1rie

View 1rie on RCSB PDB site
Description: structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex
Class: electron transport
Keywords: oxidoreductase, cytochrome bc1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport
Deposited on 1996-02-23, released 1996-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.187
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rieske iron-sulfur protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1riea_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rieA (A:)
    vlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlerv
    kkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyef
    tsddmvivg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rieA (A:)
    amskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdpqhdlervkk
    pewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnlevpsyefts
    ddmvivg