PDB entry 1rgy

View 1rgy on RCSB PDB site
Description: Citrobacter freundii GN346 Class C beta-Lactamase Complexed with Transition-State Analog of Cefotaxime
Class: hydrolase
Keywords: hydrolase, cephalosporinase, enzyme inhibition, phosphonate, beta-lactam antibiotics, drug design
Deposited on 2003-11-13, released 2004-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: 0.195
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Citrobacter freundii [TaxId:546]
    Gene: bla
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rgya_
  • Heterogens: PTX, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgyA (A:)
    akteqqiadivnrtitplmqeqaipgmavaiiyegkpyyftwgkadiannhpvtqqtlfe
    lgsvsktfngvlggdaiargeiklsdpvtkywpeltgkqwrgisllhlatytagglplqi
    pdditdkaallrfyqnwqpqwtpgakrlyanssiglfgalavkpsgmsyeeamtrrvlqp
    lklahtwitvpqseqknyawgyregkpvhvspgqldaeaygvkssvidmarwvqanmdas
    hvqektlqqgielaqsrywrigdmyqglgwemlnwplkadsiingsdskvalaalpavev
    nppvpavkaswvhktgstggfgsyvafvpeknlgivmlanksypnpvrveaawrileklq