PDB entry 1rgq

View 1rgq on RCSB PDB site
Description: M9A HCV Protease complex with pentapeptide keto-amide inhibitor
Deposited on 2003-11-12, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.279
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1rgq.1
  • Chain 'B':
    Domains in SCOP 1.71: d1rgq.2
  • Chain 'C':
    Domains in SCOP 1.71: d1rgq.2
  • Chain 'D':
    Domains in SCOP 1.71: d1rgq.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rgqA (A:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqA (A:)
    qvegevqivstatqtflatcingvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpa
    pqgsrsltpctcgssdlylvtrhadvipvrrrgdsrgsllsprpisylkgssggpllcpa
    ghavglfraavctrgvtkavdfipvenlettmrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rgqB (B:)
    masmtggqqmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcin
    gvcwtvyhgagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtr
    hadvipvrrrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdf
    ipvenlettmrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqB (B:)
    qmgapitayaqqtrgllgciitsltgrdknqvegevqivstatqtflatcingvcwtvyh
    gagtrtiaspkgpviqmytnvdqdlvgwpapqgsrsltpctcgssdlylvtrhadvipvr
    rrgdsrgsllsprpisylkgssggpllcpaghavglfraavctrgvtkavdfipvenlet
    tmrsgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rgqC (C:)
    kgsvvivgrivlsgkpaiipkk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rgqD (D:)
    kgsvvivgrivlsgkpaiipkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rgqD (D:)
    gsvvivgrivlsgkpai