PDB entry 1rfs

View 1rfs on RCSB PDB site
Description: rieske soluble fragment from spinach
Class: iron-sulfur protein
Keywords: iron-sulfur protein, electron transport
Deposited on 1997-08-14, released 1998-01-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.17
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rieske protein
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1rfsa_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfsA (A:)
    fvppgggagtggtiakdalgndviaaewlkthapgdrtltqglkgdptylvvesdktlat
    fginavcthlgcvvpfnaaenkficpchgsqynnqgrvvrgpaplslalahcdvddgkvv
    fvpwtetdfrtgeapwwsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfsA (A:)
    tiakdalgndviaaewlkthapgdrtltqglkgdptylvvesdktlatfginavcthlgc
    vvpfnaaenkficpchgsqynnqgrvvrgpaplslalahcdvddgkvvfvpwtetdfrtg
    eapwwsa