PDB entry 1rfn

View 1rfn on RCSB PDB site
Description: human coagulation factor ixa in complex with p-amino benzamidine
Deposited on 1999-04-19, released 1999-09-01
The last revision prior to the SCOP 1.61 freeze date was dated 1999-09-01, with a file datestamp of 1999-08-31.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1rfna_
  • Chain 'B':
    Domains in SCOP 1.61: d1rfnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfnA (A:)
    vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
    tehteqkrnviriiphhnynaainkynhdialleldeplvlnsyvtpiciadkeytnifl
    kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftiynnmfcagfheggrds
    cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfnB (B:)
    mtcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtsk