PDB entry 1rfj

View 1rfj on RCSB PDB site
Description: Crystal Structure of Potato Calmodulin PCM6
Class: metal binding protein
Keywords: plant calmodulin, crystal structure, PCM6, METAL BINDING PROTEIN
Deposited on 2003-11-10, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.228
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: calmodulin
    Species: Solanum tuberosum [TaxId:4113]
    Gene: PCM6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1rfja_
  • Heterogens: CA, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rfjA (A:)
    madqltedqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltde
    evdemireadvdgdgqinydefvkvmmak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfjA (A:)
    madqltedqisefkeafslfdkdgdgcittkelgtvmrslgqnpteaelqdminevdadg
    ngtidfpeflnlmarkmkdtdseeelkeafrvfdkdqngfisaaelrhvmtnlgekltde
    evdemireadvdgdgqinydefvkvmma