PDB entry 1rfd

View 1rfd on RCSB PDB site
Description:
Deposited on 2003-11-07, released 2003-11-18
The last revision prior to the SCOP 1.67 freeze date was dated 2003-11-18, with a file datestamp of 2003-11-18.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.183
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1rfdh1, d1rfdh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.67: d1rfdl1, d1rfdl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rfdH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggastsgsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavl
    qsdlytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rfdH (H:)
    evtlqesggglvqpggsmklscaasgftfsdawvdwvrqspgkglewvaeirnkannhat
    kytesvkgrftisrddskssvylqmnslraedtgiyyctsvpqlgrgfaywgqgtlvtvs
    aasttppsvyplapgsggagsmvtlgclvkgyfpepvtvtwnsgalssgvhtfpavlqsd
    lytlsssvtvpsstwpsqtvtcnvahpasstqvdkkivpk
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rfdL (L:)
    divmtqaapsvpvtpgesvsiscrssksllhsngytylhwflqrpgqspqlliyrvsnla
    sgvpdrfsgsgsgtaftlrfsrveaedvgvyycmqhleypftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypqditvswkidgaerssgvlnswtdqdssdstysm
    sstltltkdeyerhssytceathktstspitksfnrge