PDB entry 1rf1

View 1rf1 on RCSB PDB site
Description: Crystal Structure of Fragment D of gammaE132A Fibrinogen with the Peptide Ligand Gly-His-Arg-Pro-amide
Class: blood clotting
Keywords: BLOOD COAGULATION, FIBRINOGEN, FIBRINOGEN FRAGMENT D, RECOMBINANT FIBRINOGEN FRAGMENT D, fragment D of gammaE132A, FIBRINOGEN with GHRP-amide, BLOOD CLOTTING
Deposited on 2003-11-07, released 2004-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.234
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rf1a_
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rf1b1, d1rf1b2
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679 (0-End)
      • engineered (36)
    Domains in SCOPe 2.07: d1rf1c1, d1rf1c2
  • Chain 'D':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rf1d_
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rf1e1, d1rf1e2
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02679
      • engineered (36)
    Domains in SCOPe 2.07: d1rf1f1, d1rf1f2
  • Chain 'G':
    Compound: GHRP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RF1 (0-3)
  • Chain 'H':
    Compound: GHRP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RF1 (0-3)
  • Chain 'I':
    Compound: GHRP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RF1 (0-3)
  • Chain 'J':
    Compound: GHRP peptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1RF1 (0-3)
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rf1A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1A (A:)
    iekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqle
    qvia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rf1B (B:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1B (B:)
    iptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiirkgge
    tsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnvatnt
    dgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqneankyqi
    svnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcskedgg
    gwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirpffp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rf1C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqlaaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqlaaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rf1D (D:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1D (D:)
    iqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rf1E (E:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskedgggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1E (E:)
    lrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiirkggetsem
    yliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnvatntdgkn
    ycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqneankyqisvnk
    yrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcskedgggwwy
    nrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirpffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1rf1F (F:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqlaaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rf1F (F:)
    hdssirylqeiynsnnqkivnlkekvaqlaaqcqepckdtvqihditgkdcqdiankgak
    qsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfghlsptg
    ttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrltyayfa
    ggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwmnkchag
    hlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.