PDB entry 1rex

View 1rex on RCSB PDB site
Description: native human lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl), glycosydase, vertebrate c-type
Deposited on 1996-08-21, released 1997-02-12
The last revision prior to the SCOP 1.73 freeze date was dated 1997-02-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.191
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1rexa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rexA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv