PDB entry 1reu

View 1reu on RCSB PDB site
Description: Structure of the bone morphogenetic protein 2 mutant L51P
Class: hormone/growth factor
Keywords: TGF-beta fold, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2003-11-07, released 2004-05-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.215
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bone morphogenetic protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12643 (0-102)
      • engineered (39)
    Domains in SCOPe 2.05: d1reua_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1reuA (A:)
    ssckrhplyvdfsdvgwndwivappgyhafychgecpfppadhlnstnhaivqtlvnsvn
    skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr