PDB entry 1rer

View 1rer on RCSB PDB site
Description: crystal structure of the homotrimer of fusion glycoprotein e1 from semliki forest virus.
Deposited on 2003-11-07, released 2004-01-27
The last revision prior to the SCOP 1.71 freeze date was dated 2004-01-27, with a file datestamp of 2004-01-27.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.265
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rerA (A:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppkdhivpya
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rerB (B:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppkdhivpya
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rerC (C:)
    yehstvmpnvvgfpykahierpgyspltlqmqvvetsleptlnleyitceyktvvpspyv
    kccgasecstkekpdyqckvytgvypfmwggaycfcdsentqlseayvdrsdvcrhdhas
    aykahtaslkakvrvmygnvnqtvdvyvngdhavtiggtqfifgplssawtpfdnkivvy
    kdevfnqdfppygsgqpgrfgdiqsrtvesndlyantalklarpspgmvhvpytqtpsgf
    kywlkekgtalntkapfgcqiktnpvramncavgnipvsmnlpdsaftriveaptiidlt
    ctvatcthssdfggvltltyktnkngdcsvhshsnvatlqeatakvktagkvtlhfstas
    aspsfvvslcsaratcsasceppkdhivpya