PDB entry 1rei

View 1rei on RCSB PDB site
Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
Class: immunoglobulin(part)sequesters antigens
Keywords: immunoglobulin(part)sequesters antigens
Deposited on 1976-03-17, released 1976-05-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: bence-jones protein rei (light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01607 (0-106)
  Domains in SCOPe 2.06: d1reia_
• Chain 'B':
  Compound: bence-jones protein rei (light chain)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01607 (0-106)
  Domains in SCOPe 2.06: d1reib_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1reiA (A:)
  diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
  rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1reiB (B:)
  diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
  rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit