PDB entry 1rei

View 1rei on RCSB PDB site
Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
Class: immunoglobulin(part)sequesters antigens
Keywords: immunoglobulin(part)sequesters antigens
Deposited on 1976-03-17, released 1976-05-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bence-jones protein rei (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1reia_
  • Chain 'B':
    Compound: bence-jones protein rei (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1reib_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1reiA (A:)
    diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
    rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1reiB (B:)
    diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
    rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit