PDB entry 1rei

View 1rei on RCSB PDB site
Description: the molecular structure of a dimer composed of the variable portions of the bence-jones protein rei refined at 2.0 angstroms resolution
Deposited on 1976-03-17, released 1976-05-19
The last revision prior to the SCOP 1.65 freeze date was dated 1984-02-17, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1reia_
  • Chain 'B':
    Domains in SCOP 1.65: d1reib_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1reiA (A:)
    diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
    rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1reiB (B:)
    diqmtqspsslsasvgdrvtitcqasqdiikylnwyqqtpgkapklliyeasnlqagvps
    rfsgsgsgtdytftisslqpediatyycqqyqslpytfgqgtklqit