PDB entry 1re4

View 1re4 on RCSB PDB site
Description: Crystal Structure of Fragment D of BbetaD398A Fibrinogen
Class: blood clotting
Keywords: RECOMBINANT FIBRINOGEN FRAGMENT D, RECOMBINANT FIBRINOGEN, Mutant fibrinogen, variant fibrinogen, BbetaD398A fibrinogen, BLOOD CLOTTING
Deposited on 2003-11-06, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.22
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re4a_
  • Chain 'B':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02675
      • engineered (249)
    Domains in SCOPe 2.07: d1re4b1, d1re4b2
  • Chain 'C':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re4c1, d1re4c2
  • Chain 'D':
    Compound: Fibrinogen alpha/alpha-E Chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re4d_
  • Chain 'E':
    Compound: fibrinogen beta chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02675
      • engineered (249)
    Domains in SCOPe 2.07: d1re4e1, d1re4e2
  • Chain 'F':
    Compound: Fibrinogen gamma chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FGG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1re4f1, d1re4f2
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1re4A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4A (A:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqvia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1re4B (B:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4B (B:)
    detvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkecee
    iirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgf
    gnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqn
    eankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkq
    cskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmk
    irpffp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1re4C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4C (C:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1re4D (D:)
    viekvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkql
    eqviak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4D (D:)
    kvqhiqllqknvraqlvdmkrlevdidikirscrgscsralarevdlkdyedqqkqleqv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1re4E (E:)
    hqlyidetvnsniptnlrvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsg
    keceeiirkggetsemyliqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdp
    ykqgfgnvatntdgknycglpgeywlgndkisqltrmgptelliemedwkgdkvkahygg
    ftvqneankyqisvnkyrgtagnalmdgasqlmgenrtmtihngmffstydrdndgwlts
    dprkqcskeagggwwynrchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmr
    kmsmkirpffpqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4E (E:)
    rvlrsilenlrskiqklesdvsaqmeycrtpctvscnipvvsgkeceeiirkggetsemy
    liqpdssvkpyrvycdmntenggwtviqnrqdgsvdfgrkwdpykqgfgnvatntdgkny
    cglpgeywlgndkisqltrmgptelliemedwkgdkvkahyggftvqneankyqisvnky
    rgtagnalmdgasqlmgenrtmtihngmffstydrdndgwltsdprkqcskeagggwwyn
    rchaanpngryywggqytwdmakhgtddgvvwmnwkgswysmrkmsmkirpffp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1re4F (F:)
    yeasilthdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqd
    iankgakqsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegf
    ghlsptgttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyr
    ltyayfaggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgww
    mnkchaghlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrltig
    egqqhhlggak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re4F (F:)
    hdssirylqeiynsnnqkivnlkekvaqleaqcqepckdtvqihditgkdcqdiankgak
    qsglyfikplkanqqflvyceidgsgngwtvfqkrldgsvdfkknwiqykegfghlsptg
    ttefwlgnekihlistqsaipyalrveledwngrtstadyamfkvgpeadkyrltyayfa
    ggdagdafdgfdfgddpsdkfftshngmqfstwdndndkfegncaeqdgsgwwmnkchag
    hlngvyyqggtyskastpngydngiiwatwktrwysmkkttmkiipfnrlt