PDB entry 1rdu

View 1rdu on RCSB PDB site
Description: nmr structure of a putative nifb protein from thermotoga (tm1290), which belongs to the duf35 family
Class: biosynthetic protein
Keywords: ATNOS, CANDID, STRUCTURAL GENOMICS, JOINT CENTER FOR STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Nitrogen fixation NifB, BIOSYNTHETIC PROTEIN
Deposited on 2003-11-06, released 2004-07-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1290
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rdua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rduA (A:)
    marvaipsvgkdlssmvsdrfaraeyfiiydtesgnvevventiadahgtgpkvvqslvs
    kgveyliasnvgrnafetlkaagvkvyrfeggtvqeaidafsegrleelttftreg