PDB entry 1rdt

View 1rdt on RCSB PDB site
Description: Crystal Structure of a new rexinoid bound to the RXRalpha ligand binding doamin in the RXRalpha/PPARgamma heterodimer
Class: hormone/growth factor
Keywords: Hormone, receptor, polymorphism, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2003-11-06, released 2004-11-09
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor RXR-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: RXRA, NR2B1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rdta_
  • Chain 'B':
    Compound: LxxLL motif coactivator
    Database cross-references and differences (RAF-indexed):
    • PDB 1RDT
  • Chain 'D':
    Compound: Peroxisome proliferator activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37231 (13-283)
      • cloning artifact (12)
    Domains in SCOPe 2.01: d1rdtd_
  • Chain 'E':
    Compound: LxxLL motif coactivator
    Database cross-references and differences (RAF-indexed):
    • PDB 1RDT
  • Heterogens: L79, 570, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rdtA (A:)
    mkkgsanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlv
    ewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsa
    gvgaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasl
    eayckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphq
    mt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rdtA (A:)
    edmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragw
    nelliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkt
    elgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpal
    rsiglkclehlfffkligdtpidtflmemle
    

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rdtD (D:)
    mkkghhhhhhgraesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmn
    slmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlnd
    qvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavk
    fnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfa
    kllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rdtD (D:)
    aesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmevairifqg
    cqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvliseg
    qgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnvk
    piediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdms
    lhpllqeiykdly
    

  • Chain 'E':
    No sequence available.