PDB entry 1rdq

View 1rdq on RCSB PDB site
Description: Hydrolysis of ATP in the crystal of Y204A mutant of cAMP-dependent protein kinase
Class: transferase/transferase inhibitor
Keywords: cAMP-dependent protein kinase,catalytic mechanism, ATP hydrolysis, two nucleotide states
Deposited on 2003-11-05, released 2004-04-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-04-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.26 Å
R-factor: 0.162
AEROSPACI score: 0.93 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: cAMP-dependent protein kinase, alpha-catalytic subunit
    Species: MUS MUSCULUS
    Gene: Prkaca, Pkaca
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05132 (0-349)
      • modified residue (196)
      • engineered (203)
      • modified residue (337)
    Domains in SCOP 1.75: d1rdqe_
  • Chain 'I':
    Compound: cAMP-dependent protein kinase inhibitor, alpha form
    Species: synthetic, synthetic
  • Heterogens: PO4, MG, ADP, ATP, MRD, GOL, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rdqE (E:)
    gnaaaakkgseqesvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlv
    khkesgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvm
    eyvaggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyi
    qvtdfgfakrvkgrtwtlcgtpealapeiilskgynkavdwwalgvliyemaagyppffa
    dqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfatt
    dwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rdqE (E:)
    gnaaasvkeflakakedflkkwetpsqntaqldqfdriktlgtgsfgrvmlvkhkesgnh
    yamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvaggem
    fshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfa
    krvkgrtwtlcgtpealapeiilskgynkavdwwalgvliyemaagyppffadqpiqiye
    kivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqr
    kveapfipkfkgpgdtsnfddyeeeeirvsinekcgkeftef
    

  • Chain 'I':
    No sequence available.