PDB entry 1rdg

View 1rdg on RCSB PDB site
Description: rubredoxin from desulfovibrio gigas. a molecular model of the oxidized form at 1.4 angstroms resolution
Class: electron transfer(iron-sulfur protein)
Keywords: electron transfer(iron-sulfur protein)
Deposited on 1988-03-17, released 1989-04-19
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.136
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1rdga_
  • Heterogens: FE, FOR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rdgA (A:)
    mdiyvctvcgyeydpakgdpdsgikpgtkfedlpddwacpvcgaskdafekq