PDB entry 1rd4

View 1rd4 on RCSB PDB site
Description: An allosteric inhibitor of LFA-1 bound to its I-domain
Class: immune system
Keywords: immune system
Deposited on 2003-11-05, released 2004-03-30
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.236
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rd4a_
  • Chain 'B':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rd4b_
  • Chain 'C':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rd4c_
  • Chain 'D':
    Compound: Integrin alpha-L
    Species: Homo sapiens [TaxId:9606]
    Gene: ITGAL, CD11A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1rd4d_
  • Heterogens: L08

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1rd4A (A:)
    gamscikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsykte
    fdfsdyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdg
    eatdsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlft
    elqkkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd4A (A:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vieg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rd4B (B:)
    gamscikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsykte
    fdfsdyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdg
    eatdsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlft
    elqkkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd4B (B:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vieg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1rd4C (C:)
    gamscikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsykte
    fdfsdyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdg
    eatdsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlft
    elqkkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd4C (C:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vieg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1rd4D (D:)
    gamscikgnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsykte
    fdfsdyvkrkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdg
    eatdsgnidaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlft
    elqkkiyvieg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rd4D (D:)
    gnvdlvflfdgsmslqpdefqkildfmkdvmkklsntsyqfaavqfstsyktefdfsdyv
    krkdpdallkhvkhmllltntfgainyvatevfreelgarpdatkvliiitdgeatdsgn
    idaakdiiryiigigkhfqtkesqetlhkfaskpasefvkildtfeklkdlftelqkkiy
    vieg