PDB entry 1rcx

View 1rcx on RCSB PDB site
Description: non-activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate
Class: lyase (carbon-carbon)
Keywords: lyase (carbon-carbon)
Deposited on 1996-12-06, released 1997-06-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxb1, d1rcxb2
  • Chain 'C':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxc_
  • Chain 'E':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxe1, d1rcxe2
  • Chain 'F':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxf_
  • Chain 'H':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxh1, d1rcxh2
  • Chain 'I':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxi_
  • Chain 'K':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxk1, d1rcxk2
  • Chain 'L':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxl1, d1rcxl2
  • Chain 'M':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxm_
  • Chain 'O':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxo1, d1rcxo2
  • Chain 'P':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxp_
  • Chain 'R':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxr1, d1rcxr2
  • Chain 'S':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxs_
  • Chain 'T':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxt_
  • Chain 'V':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1rcxv1, d1rcxv2
  • Chain 'W':
    Compound: ribulose bisphosphate carboxylase/oxygenase
    Species: Spinacia oleracea [TaxId:3562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00870 (0-122)
      • conflict (1)
      • conflict (5-6)
      • conflict (8)
      • conflict (10)
      • conflict (108)
      • conflict (112)
    Domains in SCOPe 2.07: d1rcxw_
  • Heterogens: RUB, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1rcxB (B:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxB (B:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxC (C:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1rcxE (E:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxE (E:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxF (F:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1rcxH (H:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxH (H:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxI (I:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1rcxK (K:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxK (K:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1rcxL (L:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxL (L:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxM (M:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1rcxO (O:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxO (O:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxP (P:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1rcxR (R:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxR (R:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxS (S:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxT (T:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1rcxV (V:)
    mspqtetkasvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaae
    sstgtwttvwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsi
    vgnvfgfkalralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklgl
    saknygravyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghyl
    natagtcedmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhav
    idrqknhgmhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsr
    giyftqswvstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavan
    rvaleacvqarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1rcxV (V:)
    asvgfkagvkdykltyytpeyetldtdilaafrvspqpgvppeeagaavaaesstgtwtt
    vwtdgltnldrykgrcyhiepvageenqyicyvaypldlfeegsvtnmftsivgnvfgfk
    alralrledlripvayvktfqgpphgiqverdklnkygrpllgctikpklglsaknygra
    vyeclrggldftkddenvnsqpfmrwrdrflfcaealykaqaetgeikghylnatagtce
    dmmkravfarelgvpivmhdyltggftanttlshycrdnglllhihramhavidrqknhg
    mhfrvlakalrlsggdhihsgtvvgklegerditlgfvdllrddytekdrsrgiyftqsw
    vstpgvlpvasggihvwhmpalteifgddsvlqfgggtlghpwgnapgavanrvaleacv
    qarnegrdlaregntiireatkwspelaaacevwkeikfefpamdtv
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1rcxW (W:)
    mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
    yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
    agy